HPA012640

PAWR antibody from Sigma-Aldrich
par-4, PAR4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012640
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012640, RRID:AB_1855748
Product name
Anti-PAWR antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012640
Antibody type
Polyclonal
Antigen
PRKC apoptosis WT1 regulator protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGF
PRYNRDANVSGTLVSSSTLEKKIEDLEKEVVRERQ
ENLRLVRLMQDKEEMIGKLKEEIDLLNRDLDDIED
ENEQLKQENKT
Storage
-20C
Provider Type Product Number
- No reagents -