HPA006960

LITAF antibody from Sigma-Aldrich
FLJ38636, PIG7, SIMPLE, TP53I7
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006960
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006960, RRID:AB_1079254
Product name
Anti-LITAF antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006960
Antibody type
Polyclonal
Antigen
Lipopolysaccharide-induced tumor necrosis factor-alpha factor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
APPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDG
KGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFL
DRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLC
LLGCIAGCCFIPFCVDALQDVDHYCPNC
Storage
-20C
Provider Type Product Number
- No reagents -