AV43656

ABCD4 antibody from Sigma-Aldrich
EST352188, P70R, PMP69, PXMP1L
No application information provided.

Antibody data

Product number
AV43656
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV43656, RRID:AB_1844437
Product name
Anti-ABCD4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV43656
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ABCD4 with an internal ID of P11645
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
RVLGGLWTSTRGSVQMLTDFGPHGVLFLPQKPFFT
DGTLREQVIYPLKEV
Storage
-20C
Provider Type Product Number
- No reagents -