HPA003396

ABCD4 antibody from Sigma-Aldrich
EST352188, P70R, PMP69, PXMP1L
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003396
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003396, RRID:AB_1078078
Product name
Anti-ABCD4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003396
Antibody type
Polyclonal
Antigen
ATP-binding cassette sub-family D member 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TLVSKNAFVCIYLISCFTQLIDLSTTLSDVAGYTH
RIGQLRETLLDMSLKSQDCEILGESEWGLDTPPGW
PAAEPADTAFLLERVSISAPSSDKPLIKDLSLKIS
EGQSLLITGNTGTGK
Storage
-20C
Provider Type Product Number
- No reagents -