HPA024218

EIF2B3 antibody from Atlas Antibodies
EIF-2B, EIF2Bgamma
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024218
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024218, RRID:AB_1848068
Product name
Anti-EIF2B3
Provider product page
Atlas Antibodies - HPA024218
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
YPLNLLERVGFEEVIVVTTRDVQKALCAEFKMKMK
PDIVCIPDDADMGTADSLRYIYPKLKTDVLVLSCD
LITDVALHEVVDLFRAYDASLAMLMRK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -