HPA024219

EIF2B3 antibody from Sigma-Aldrich
EIF-2B, EIF2Bgamma
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024219
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024219, RRID:AB_1848069
Product name
Anti-EIF2B3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024219
Antibody type
Polyclonal
Antigen
Translation initiation factor eIF-2B subunit gamma recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KEANTLNLAPYDACWNACRGDRWEDLSRSQVRCYV
HIMKEGLCSRVSTLGLYMEANRQVPKLLSALCPEE
PPVHSSAQIVSKHLVG
Storage
-20C
Provider Type Product Number
- No reagents -