H00000840-B01P

CASP7 antibody from Abnova Corporation
CMH-1, ICE-LAP3, MCH3

Antibody data

Product number
H00000840-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000840-B01P, RRID:AB_1572142
Product name
CASP7 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00000840-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human CASP7 protein.
Antigen sequence
MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSL
FSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKC
IIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLG
FDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACI
LLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLL
EKPKLFFIQACRGTELDDGIQADSGPINDTDANPR
YKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQAL
CSILEEHGKDLEIMQILTRVNDRVARHFESQSDDP
HFHEKKQIPCVVSMLTKELYFSQ
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -