Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009096-M06 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009096-M06, RRID:AB_875877
- Product name
- TBX18 monoclonal antibody (M06), clone 4D3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant TBX18.
- Antigen sequence
STLLQGTGNGVPATHPHLLSGSSCSSPAFHLGPNT
SQLCSLAPADYSACARSGLTLNRYSTSLAETYNRL
TNQAGETFAPPRTPSYVGVSSSTSVNMSMGGTDGD
TF- Isotype
- IgG
- Antibody clone number
- 4D3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- TBX18 monoclonal antibody (M06), clone 4D3. Western Blot analysis of TBX18 expression in PC-12(Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to TBX18 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol