HPA006717

XRCC1 antibody from Sigma-Aldrich
RCC
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006717
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006717, RRID:AB_1858896
Product name
Anti-XRCC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006717
Antibody type
Polyclonal
Antigen
DNA-repair protein XRCC1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WDRVKIVCSQPYSKDSPFGLSFVRFHSPPDKDEAE
APSQKVTVTKLGQFRVKEEDESANSLRPGALFFSR
INKTSPVTASDPAGPSYAAATLQASSAASSASPVS
RAIGSTSKPQESPKGKRKLDLNQEEKKT
Storage
-20C
Provider Type Product Number
- No reagents -