Antibody data
- Antibody Data
- Antigen structure
- References [7]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004595-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004595-M01, RRID:AB_464021
- Product name
- MUTYH monoclonal antibody (M01), clone 4D10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MUTYH.
- Antigen sequence
KLTYQVYGLALEGQTPVTTVPPGARWLTQEEFHTA
AVSTAMKKVFRVYQGQQPGTCMGSKRSQVSSPCSR
KKPRMGQQVLDNFFRSHISTDAHSLNSAAQ- Isotype
- IgG
- Antibody clone number
- 4D10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Functional Complementation Assay for 47 MUTYH Variants in a MutY-Disrupted Escherichia coli Strain.
Impaired 8-hydroxyguanine repair activity of MUTYH variant p.Arg109Trp found in a Japanese patient with early-onset colorectal cancer.
Visualization of the physical and functional interaction between hMYH and hRad9 by Dronpa bimolecular fluorescence complementation.
Cancer-associated variants and a common polymorphism of MUTYH exhibit reduced repair of oxidative DNA damage using a GFP-based assay in mammalian cells.
Human MutY homolog induces apoptosis in etoposide-treated HEK293 cells.
Effects of base excision repair proteins on mutagenesis by 8-oxo-7,8-dihydroguanine (8-hydroxyguanine) paired with cytosine and adenine.
Immunohistochemistry is not an accurate first step towards the molecular diagnosis of MUTYH-associated polyposis.
Komine K, Shimodaira H, Takao M, Soeda H, Zhang X, Takahashi M, Ishioka C
Human mutation 2015 Jul;36(7):704-11
Human mutation 2015 Jul;36(7):704-11
Impaired 8-hydroxyguanine repair activity of MUTYH variant p.Arg109Trp found in a Japanese patient with early-onset colorectal cancer.
Shinmura K, Goto M, Tao H, Kato H, Suzuki R, Nakamura S, Matsuda T, Yin G, Morita M, Kono S, Sugimura H
Oxidative medicine and cellular longevity 2014;2014:617351
Oxidative medicine and cellular longevity 2014;2014:617351
Visualization of the physical and functional interaction between hMYH and hRad9 by Dronpa bimolecular fluorescence complementation.
Agustina L, Hahm SH, Han SH, Tran AH, Chung JH, Park JH, Park JW, Han YS
BMC molecular biology 2014 Aug 15;15:17
BMC molecular biology 2014 Aug 15;15:17
Cancer-associated variants and a common polymorphism of MUTYH exhibit reduced repair of oxidative DNA damage using a GFP-based assay in mammalian cells.
Raetz AG, Xie Y, Kundu S, Brinkmeyer MK, Chang C, David SS
Carcinogenesis 2012 Nov;33(11):2301-9
Carcinogenesis 2012 Nov;33(11):2301-9
Human MutY homolog induces apoptosis in etoposide-treated HEK293 cells.
Hahm SH, Chung JH, Agustina L, Han SH, Yoon IS, Park JH, Kang LW, Park JW, Na JJ, Han YS
Oncology letters 2012 Dec;4(6):1203-1208
Oncology letters 2012 Dec;4(6):1203-1208
Effects of base excision repair proteins on mutagenesis by 8-oxo-7,8-dihydroguanine (8-hydroxyguanine) paired with cytosine and adenine.
Suzuki T, Harashima H, Kamiya H
DNA repair 2010 May 4;9(5):542-50
DNA repair 2010 May 4;9(5):542-50
Immunohistochemistry is not an accurate first step towards the molecular diagnosis of MUTYH-associated polyposis.
van der Post RS, Kets CM, Ligtenberg MJ, van Krieken JH, Hoogerbrugge N
Virchows Archiv : an international journal of pathology 2009 Jan;454(1):25-9
Virchows Archiv : an international journal of pathology 2009 Jan;454(1):25-9
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- MUTYH monoclonal antibody (M01), clone 4D10 Western Blot analysis of MUTYH expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of MUTYH expression in transfected 293T cell line by MUTYH monoclonal antibody (M01), clone 4D10.Lane 1: MUTYH transfected lysate(59.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged MUTYH is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of MUTYH transfected lysate using anti-MUTYH monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with MUTYH MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol