HPA008732

MUTYH antibody from Sigma-Aldrich
MYH
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008732
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008732, RRID:AB_1854219
Product name
Anti-MUTYH antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008732
Antibody type
Polyclonal
Antigen
A/G-specific adenine DNA glycosylase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PDVEECAPNTGQCHLCLPPSEPWDQTLGVVNFPRK
ASRKPPREESSATCVLEQPGALGAQILLVQRPNSG
LLAGLWEFPSVTWEPSEQLQRKALLQELQRWA
Storage
-20C
Provider Type Product Number
- No reagents -