HPA017871

PSMC5 antibody from Sigma-Aldrich
p45, p45/SUG, S8, SUG-1, SUG1, TBP10, TRIP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017871
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017871, RRID:AB_1857638
Product name
Anti-PSMC5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017871
Antibody type
Polyclonal
Antigen
26S protease regulatory subunit 8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRK
MNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYA
LRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLW
K
Storage
-20C
Provider Type Product Number
- No reagents -