HPA017871

PSMC5 antibody from Atlas Antibodies
p45, p45/SUG, S8, SUG-1, SUG1, TBP10, TRIP1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA017871
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017871, RRID:AB_1857638
Product name
Anti-PSMC5
Provider product page
Atlas Antibodies - HPA017871
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRK
MNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYA
LRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLW
K
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -