Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN970691 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Flap Structure-Specific Endonuclease 1 (FEN1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- Other
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
APSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQ
GGDVL QNEEGETTSH- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- WB Suggested Anti-FEN1 Antibody Positive Control: Lane1: hFEN1 (1-336), Lane2: uninduced BL21, Lane3: 2h induced BL21, Lane4: overnight induced BL21 Primary Antibody Dilution: 1: h000Secondary Antibody: Goat anti-rabbit-HRPSecondry Antibody Dilution: 1:10,000Submitted by: Prof. Jon R Sayers, University of Sheffield Medical School
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- WB Suggested Anti-FEN1 AntibodyTitration: 1.0 μg/mL Positive Control: 293T Whole Cell FEN1 is supported by BioGPS gene expression data to be expressed in HEK293T