HPA006721

POLH antibody from Sigma-Aldrich
RAD30A, XP-V
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006721
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006721, RRID:AB_1847785
Product name
Anti-POLH antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006721
Antibody type
Polyclonal
Antigen
DNA polymerase eta recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PPLTMLFLCATKFSASAPSSSTDITSFLSSDPSSL
PKVPVTSSEAKTQGSGPAVTATKKATTSLESFFQK
AAERQKVKEASLSSLTAPTQAPMSNSPSKPSLPFQ
TSQSTGTE
Storage
-20C
Provider Type Product Number
- No reagents -