Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA003456 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA003456, RRID:AB_10603840
- Product name
- Anti-ZEB2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SPVKPMDSITSPSIAELHNSVTNCDPPLRLTKPSH
FTNIKPVEKLDHSRSNTPSPLNLSSTSSKNSHSSS
YTPNSFSSEELQAEPLDLSLPKQMKEPKSIIATKN
KTKASSISLDHNSVSSSSE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Identification of a ZEB2-MITF-ZEB1 transcriptional network that controls melanogenesis and melanoma progression.
Protein expression of ZEB2 in renal cell carcinoma and its prognostic significance in patient survival.
Overexpression of ZEB2 in peritumoral liver tissue correlates with favorable survival after curative resection of hepatocellular carcinoma.
Extensive expression of craniofacial related homeobox genes in canine mammary sarcomas
Denecker G, Vandamme N, Akay O, Koludrovic D, Taminau J, Lemeire K, Gheldof A, De Craene B, Van Gele M, Brochez L, Udupi GM, Rafferty M, Balint B, Gallagher WM, Ghanem G, Huylebroeck D, Haigh J, van den Oord J, Larue L, Davidson I, Marine JC, Berx G
Cell death and differentiation 2014 Aug;21(8):1250-61
Cell death and differentiation 2014 Aug;21(8):1250-61
Protein expression of ZEB2 in renal cell carcinoma and its prognostic significance in patient survival.
Fang Y, Wei J, Cao J, Zhao H, Liao B, Qiu S, Wang D, Luo J, Chen W
PloS one 2013;8(5):e62558
PloS one 2013;8(5):e62558
Overexpression of ZEB2 in peritumoral liver tissue correlates with favorable survival after curative resection of hepatocellular carcinoma.
Cai MY, Luo RZ, Chen JW, Pei XQ, Lu JB, Hou JH, Yun JP
PloS one 2012;7(2):e32838
PloS one 2012;7(2):e32838
Extensive expression of craniofacial related homeobox genes in canine mammary sarcomas
Wensman H, Göransson H, Leuchowius K, Strömberg S, Pontén F, Isaksson A, Rutteman G, Heldin N, Pejler G, Hellmén E
Breast Cancer Research and Treatment 2009 November;118(2):333-343
Breast Cancer Research and Treatment 2009 November;118(2):333-343
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines SK-MEL-30 and Caco-2 using Anti-ZEB2 antibody. Corresponding ZEB2 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using HPA003456 antibody. Corresponding ZEB2 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows moderate nuclear positivity in glial cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human glioma shows moderate nuclear positivity in tumor cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows moderate nuclear positivity in a subset of lymphoid cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows no positivity as expected.
- Sample type
- HUMAN
