Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009839-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009839-M03, RRID:AB_894326
- Product name
- ZFHX1B monoclonal antibody (M03), clone 2D12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ZFHX1B.
- Antigen sequence
SITPQGYSDSEERESMPRDGESEKEHEKEGEDGYG
KLGRQDGDEEFEEEEEESENKSMDTDPETIRDEEE
TGDHSMDDSSEDGKMETKSDHEEDNMEDGM- Isotype
- IgG
- Antibody clone number
- 2D12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Langerhans cell maturation is accompanied by induction of N-cadherin and the transcriptional regulators of epithelial-mesenchymal transition ZEB1/2.
The tumor-promoting activity of 2-acetylaminofluorene is associated with disruption of the p53 signaling pathway and the balance between apoptosis and cell proliferation.
Konradi S, Yasmin N, Haslwanter D, Weber M, Gesslbauer B, Sixt M, Strobl H
European journal of immunology 2014 Feb;44(2):553-60
European journal of immunology 2014 Feb;44(2):553-60
The tumor-promoting activity of 2-acetylaminofluorene is associated with disruption of the p53 signaling pathway and the balance between apoptosis and cell proliferation.
Pogribny IP, Muskhelishvili L, Tryndyak VP, Beland FA
Toxicology and applied pharmacology 2009 Mar 15;235(3):305-11
Toxicology and applied pharmacology 2009 Mar 15;235(3):305-11
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ZFHX1B monoclonal antibody (M03), clone 2D12. Western Blot analysis of ZFHX1B expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to ZFHX1B on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol