Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501775 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger E-Box Binding Homeobox 2 (ZEB2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZEB2 antibody: synthetic peptide directed towards the middle region of human ZEB2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
LGRQDGDEEFEEEEEESENKSMDTDPETIRDEEET
GDHSM DDSSEDGKME- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Sip1 mediates an E-cadherin-to-N-cadherin switch during cranial neural crest EMT.
Atypical Mowat-Wilson patient confirms the importance of the novel association between ZFHX1B/SIP1 and NuRD corepressor complex.
Rogers CD, Saxena A, Bronner ME
The Journal of cell biology 2013 Dec 9;203(5):835-47
The Journal of cell biology 2013 Dec 9;203(5):835-47
Atypical Mowat-Wilson patient confirms the importance of the novel association between ZFHX1B/SIP1 and NuRD corepressor complex.
Verstappen G, van Grunsven LA, Michiels C, Van de Putte T, Souopgui J, Van Damme J, Bellefroid E, Vandekerckhove J, Huylebroeck D
Human molecular genetics 2008 Apr 15;17(8):1175-83
Human molecular genetics 2008 Apr 15;17(8):1175-83
No comments: Submit comment
No validations: Submit validation data