Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503563 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-G Protein-Coupled Receptor Kinase 5 (GRK5) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GRK5 antibody: synthetic peptide directed towards the middle region of human GRK5
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Zebrafish
- Host
- Rabbit
- Antigen sequence
FYAAEILCGLEDLHRENTVYRDLKPENILLDDYGH
IRISD LGLAVKIPEG- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A GRK5 polymorphism that inhibits beta-adrenergic receptor signaling is protective in heart failure.
Liggett SB, Cresci S, Kelly RJ, Syed FM, Matkovich SJ, Hahn HS, Diwan A, Martini JS, Sparks L, Parekh RR, Spertus JA, Koch WJ, Kardia SL, Dorn GW 2nd
Nature medicine 2008 May;14(5):510-7
Nature medicine 2008 May;14(5):510-7
No comments: Submit comment
No validations: Submit validation data