Antibody data

Product number
ABIN503563
Provider
antibodies-online
Product name
anti-G Protein-Coupled Receptor Kinase 5 (GRK5) (Middle Region) antibody
Provider product page
antibodies-online - ABIN503563
Antibody type
Polyclonal
Antigen
The immunogen for anti-GRK5 antibody: synthetic peptide directed towards the middle region of human GRK5
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Zebrafish
Host
Rabbit
Antigen sequence
FYAAEILCGLEDLHRENTVYRDLKPENILLDDYGH
IRISD LGLAVKIPEG
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -