HPA019652

POU2F3 antibody from Sigma-Aldrich
Epoc-1, OCT11, PLA-1, Skn-1a
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019652
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019652, RRID:AB_1855585
Product name
Anti-POU2F3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019652
Antibody type
Polyclonal
Antigen
POU domain, class 2, transcription factor 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LESMHTDIKMSGDVADSTDARSTLSQVEPGNDRNG
LDFNRQIKTEDLSDSLQQTLSHRPCHLSQGPAMMS
GNQMSGLNASPCQDMASLHPLQQLVLVPGHLQSVS
QFLLSQTQP
Storage
-20C
Provider Type Product Number
- No reagents -