Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN143333 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Islet Cell Autoantigen 1, 69kDa (ICA1) antibody
- Antibody type
- Polyclonal
- Antigen
- Fusion protein: levfhsvqetctellkiiekyqlrlnviseeenelglflkfqaerdatqagkmmdatgkalcssakqrlalctplsrlkqevatfsqravsdtlmt, corresponding to amino acids 53-148 of Human Ica69-related protein/LOC130026.
- Reactivity
- Human
- Host
- Chicken/Avian
- Vial size
- 50 µg
- Concentration
- 0.1 mg/ml
- Storage
- Store at 4C. Aliquot and store at -20C long-term.
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting