Antibody data

Product number
ABIN143333
Provider
antibodies-online
Product name
anti-Islet Cell Autoantigen 1, 69kDa (ICA1) antibody
Provider product page
antibodies-online - ABIN143333
Antibody type
Polyclonal
Antigen
Fusion protein: levfhsvqetctellkiiekyqlrlnviseeenelglflkfqaerdatqagkmmdatgkalcssakqrlalctplsrlkqevatfsqravsdtlmt, corresponding to amino acids 53-148 of Human Ica69-related protein/LOC130026.
Reactivity
Human
Host
Chicken/Avian
Vial size
50 µg
Concentration
0.1 mg/ml
Storage
Store at 4C. Aliquot and store at -20C long-term.
Provider Type Product Number
- No reagents -