HPA017646

ICA1 antibody from Sigma-Aldrich
ICAp69
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017646
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017646, RRID:AB_1851382
Product name
Anti-ICA1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017646
Antibody type
Polyclonal
Antigen
Islet cell autoantigen 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DELLDMKSEEGACLGPVAGTPEPEGADKDDLLLLS
EIFNASSLEEGEFSKEWAAVFGDGQVKEPVPTMAL
GEPDPKAQTGSGFLPSQLLDQNMKDLQASLQEPAK
AASDLTAWFSLFADLDPLSNPDAVGKTDKEHELL
Storage
-20C
Provider Type Product Number
- No reagents -