Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN404754 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Solute Carrier Family 34 (Sodium Phosphate), Member 3 (SLC34A3) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SLC34A3 antibody: synthetic peptide directed towards the middle region of human SLC34A3
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine
- Host
- Rabbit
- Antigen sequence
GDRDEFQRAFSGSAVHGIFNWLTVLVLLPLESATA
LLERL SELALGAASL- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Hereditary hypophosphatemic rickets with hypercalciuria: a study for the phosphate transporter gene type IIc and osteoblastic function.
Yamamoto T, Michigami T, Aranami F, Segawa H, Yoh K, Nakajima S, Miyamoto K, Ozono K
Journal of bone and mineral metabolism 2007;25(6):407-13
Journal of bone and mineral metabolism 2007;25(6):407-13
No comments: Submit comment
No validations: Submit validation data