Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA030033 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA030033, RRID:AB_10601050
- Product name
- Anti-PRDM1
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
GELHHFIDGFNEEKSNWMRYVNPAHSPREQNLAAC
QNGMNIYFYTIKPIPANQELLVWYCRDFAERLHYP
YPGELTMMNLTQTQSSLKQPSTEKNELCPKNVPKR
EYSVKEILKLDSNPSKGKDLYRSNISPLTSEKDLD
DFRRRG- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Differentiation-Dependent KLF4 Expression Promotes Lytic Epstein-Barr Virus Infection in Epithelial Cells
Nawandar D, Wang A, Makielski K, Lee D, Ma S, Barlow E, Reusch J, Jiang R, Wille C, Greenspan D, Greenspan J, Mertz J, Hutt-Fletcher L, Johannsen E, Lambert P, Kenney S, Speck S
PLOS Pathogens 2015 October;11(10)
PLOS Pathogens 2015 October;11(10)
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows moderate nuclear positivity in germinal center cells and squamous epithelial cells.