Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183589 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-PR Domain Containing 1, with ZNF Domain (PRDM1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PRDM1 antibody: synthetic peptide directed towards the N terminal of human PRDM1
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
MKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGA
DGGTS VQAEASLPRN- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Immunization-induced perturbation of human blood plasma cell pool: progressive maturation, IL-6 responsiveness, and high PRDI-BF1/BLIMP1 expression are critical distinctions between antigen-specific and nonspecific plasma cells.
González-García I, Ocaña E, Jiménez-Gómez G, Campos-Caro A, Brieva JA
Journal of immunology (Baltimore, Md. : 1950) 2006 Apr 1;176(7):4042-50
Journal of immunology (Baltimore, Md. : 1950) 2006 Apr 1;176(7):4042-50
No comments: Submit comment
No validations: Submit validation data