H00009052-B01

GPRC5A antibody from Abnova Corporation
PEIG-1, RAI3, RAIG1, TIG1

Antibody data

Product number
H00009052-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009052-B01, RRID:AB_1204424
Product name
GPRC5A MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00009052-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human GPRC5A protein.
Antigen sequence
MATTVPDGCRNGLKSKYYRLCDKAEAWGIVLETVA
TAGVVTSVAFMLTLPILVCKVQDSNRRKMLPTQFL
FLLGVLGIFGLTFAFIIGLDGSTGPTRFFLFGILF
SICFSCLLAHAVSLTKLVRGRKPLSLLVILGLAVG
FSLVQDVIAIEYIVLTMNRTNVNVFSELSAPRRNE
DFVLLLTYVLFLMALTFLMSSFTFCGSFTGWKRHG
AHIYLTMLLSIAIWVAWITLLMLPDFDRRWDDTIL
SSALAANGWVFLLAYVSPEFWLLTKQRNPMDYPVE
DAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDT
LYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDY
EVKKEGS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -