HPA007928

GPRC5A antibody from Sigma-Aldrich
PEIG-1, RAI3, RAIG1, TIG1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007928
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007928, RRID:AB_1849318
Product name
Anti-GPRC5A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007928
Antibody type
Polyclonal
Antigen
Retinoic acid-induced protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQ
EEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSI
PR
Storage
-20C
Provider Type Product Number
- No reagents -