Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN504524 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Thrombopoietin (THPO) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-THPO antibody: synthetic peptide directed towards the middle region of human THPO
- Reactivity
- Human, Canine
- Host
- Rabbit
- Antigen sequence
NLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLH
PLLPD PSAPTPTPTS- Vial size
- 50 µg
Submitted references The effect of a pedometer-based community walking intervention "Walking for Wellbeing in the West" on physical activity levels and health outcomes: a 12-week randomized controlled trial.
Human thrombopoietin reduces myocardial infarct size, apoptosis, and stunning following ischaemia/reperfusion in rats.
Baker G, Gray SR, Wright A, Fitzsimons C, Nimmo M, Lowry R, Mutrie N, Scottish Physical Activity Research Collaboration (SPARColl)
The international journal of behavioral nutrition and physical activity 2008 Sep 5;5:44
The international journal of behavioral nutrition and physical activity 2008 Sep 5;5:44
Human thrombopoietin reduces myocardial infarct size, apoptosis, and stunning following ischaemia/reperfusion in rats.
Baker JE, Su J, Hsu A, Shi Y, Zhao M, Strande JL, Fu X, Xu H, Eis A, Komorowski R, Jensen ES, Tweddell JS, Rafiee P, Gross GJ
Cardiovascular research 2008 Jan;77(1):44-53
Cardiovascular research 2008 Jan;77(1):44-53
No comments: Submit comment
No validations: Submit validation data