Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA024481 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA024481, RRID:AB_1846153
- Product name
- Anti-CEP112
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RNTLHKEKDHLVNDYEQNMKLLQTKYDADINLLKQ
EHALSASKASSMIEELEQNVCQLKQQLQESELQRK
QQLRDQE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods
Jakobsen L, Vanselow K, Skogs M, Toyoda Y, Lundberg E, Poser I, Falkenby L, Bennetzen M, Westendorf J, Nigg E, Uhlen M, Hyman A, Andersen J
The EMBO Journal 2011 April;30(8):1520-1535
The EMBO Journal 2011 April;30(8):1520-1535
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & the Golgi apparatus.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human small intestine shows moderate cytoplasmic and membranous positivity in glandular cells.