HPA024481

CEP112 antibody from Sigma-Aldrich
CCDC46, MGC33887
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024481
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024481, RRID:AB_1846153
Product name
Anti-CCDC46 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024481
Antibody type
Polyclonal
Antigen
Coiled-coil domain-containing protein 46 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RNTLHKEKDHLVNDYEQNMKLLQTKYDADINLLKQ
EHALSASKASSMIEELEQNVCQLKQQLQESELQRK
QQLRDQE
Storage
-20C
Provider Type Product Number
- No reagents -