ABIN1741203

ATXN1 antibody from antibodies-online
ATX1, D6S504E, SCA1
Western blot
Recommended by provider
Immunoprecipitation
Recommended by provider
Immunohistochemistry
Recommended by provider

Antibody data

Product number
ABIN1741203
Provider
antibodies-online
Product name
anti-Ataxin 1 (ATXN1) (AA 164-197) antibody (Atto 655)
Provider product page
antibodies-online - ABIN1741203
Antibody type
Monoclonal
Antigen
Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100 % identity (34/34 amino acids identical). Human: 88 % identity (30/34 amino acids identical).
Description
Protein G Purified
Reactivity
Human, Mouse, Rat
Host
Mouse
Epitope
AA 164-197
Isotype
IgG
Antibody clone number
S76-8
Vial size
100 μg
Concentration
1 mg/mL
Storage
4°C
Provider Type Product Number
- No reagents -