
ATXN1 antibody from antibodies-online
ATX1, D6S504E, SCA1
Western blot
Recommended by provider
Recommended by provider
Recommended by provider

Antibody data

Product number
Product name
anti-Ataxin 1 (ATXN1) (AA 164-197) antibody (Biotin)
Provider product page
antibodies-online - ABIN1741208
Antibody type
Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100 % identity (34/34 amino acids identical). Human: 88 % identity (30/34 amino acids identical).
Protein G Purified
Human, Mouse, Rat
AA 164-197
Antibody clone number
Vial size
100 μg
1 mg/mL
Provider Type Product Number
- No reagents -