HPA026997

PRDM10 antibody from Atlas Antibodies
KIAA1231, MGC131802, PFM7
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA026997
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026997, RRID:AB_1855681
Product name
Anti-PRDM10
Provider product page
Atlas Antibodies - HPA026997
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SPSHIQGSSSTQGQALQQQQQQQQNSSVQHTYLPS
AWNSFRGYSSEIQMMTLPPGQFVITDSGVATPVTT
GQVKAVTSGHYVLSESQSELEEKQTSALSGGVQVE
PPAHSDSLDPQTNSQQQTTQYIITTTTNGNGS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -