H00002967-B01P

GTF2H3 antibody from Abnova Corporation
BTF2, P34, TFIIH

Antibody data

Product number
H00002967-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002967-B01P, RRID:AB_1237831
Product name
GTF2H3 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00002967-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human GTF2H3 protein.
Antigen sequence
MVSDEDELNLLVIVVDANPIWWGKQALKESQFTLS
KCIDAVMVLGNSHLFMNRSNKLAVIASHIQESRFL
YPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLT
SANEVIVEEIKDLMTKSDIKGQHTETLLAGSLAKA
LCYIHRMNKEVKDNQEMKSRILVIKAAEDSALQYM
NFMNVIFAAQKQNILIDACVLDSDSGLLQQACDIT
GGLYLKVPQMPSLLQYLLWVFLPDQDQRSQLILPP
PVHVDYRAACFCHRNLIEIGYVCSVCLSIFCNFSP
ICTTCETAFKISLPPVLKAKKKKLKVSA
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -