Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182854 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Claudin 16 (CLDN16) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CLDN16 antibody: synthetic peptide directed towards the C terminal of human CLDN16
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
FLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAG
VSMAK SYSAPRTETA- Vial size
- 50 µg
Submitted references Claudin-19 and the barrier properties of the human retinal pigment epithelium.
MicroRNA-204/211 alters epithelial physiology.
A novel claudin 16 mutation associated with childhood hypercalciuria abolishes binding to ZO-1 and results in lysosomal mistargeting.
Peng S, Rao VS, Adelman RA, Rizzolo LJ
Investigative ophthalmology & visual science 2011 Mar;52(3):1392-403
Investigative ophthalmology & visual science 2011 Mar;52(3):1392-403
MicroRNA-204/211 alters epithelial physiology.
Wang FE, Zhang C, Maminishkis A, Dong L, Zhi C, Li R, Zhao J, Majerciak V, Gaur AB, Chen S, Miller SS
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2010 May;24(5):1552-71
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2010 May;24(5):1552-71
A novel claudin 16 mutation associated with childhood hypercalciuria abolishes binding to ZO-1 and results in lysosomal mistargeting.
Müller D, Kausalya PJ, Claverie-Martin F, Meij IC, Eggert P, Garcia-Nieto V, Hunziker W
American journal of human genetics 2003 Dec;73(6):1293-301
American journal of human genetics 2003 Dec;73(6):1293-301
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting