HPA007159

GPR153 antibody from Sigma-Aldrich
PGR1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007159
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007159, RRID:AB_1849268
Product name
Anti-GPR153 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007159
Antibody type
Polyclonal
Antigen
Probable G-protein coupled receptor 153 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YRADLKAVREKCMALMANDEESDDETSLEGGISPD
LVLERSLDYGYGGDFVALDRMAKYEISALEGGLPQ
LYPLRPLQEDKMQYLQVPPTRRFSHDDADVW
Storage
-20C
Provider Type Product Number
- No reagents -