Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182671 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Acyl-CoA Synthetase Long-Chain Family Member 1 (Acsl1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ACSL1 antibody: synthetic peptide directed towards the C terminal of human ACSL1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine, Zebrafish
- Host
- Rabbit
- Antigen sequence
GSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQV
KGITL HPELFSIDNG- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Long-chain acyl-CoA synthetase 4 modulates prostaglandin E₂ release from human arterial smooth muscle cells.
Molecular cloning and sequencing of human palmitoyl-CoA ligase and its tissue specific expression.
Golej DL, Askari B, Kramer F, Barnhart S, Vivekanandan-Giri A, Pennathur S, Bornfeldt KE
Journal of lipid research 2011 Apr;52(4):782-93
Journal of lipid research 2011 Apr;52(4):782-93
Molecular cloning and sequencing of human palmitoyl-CoA ligase and its tissue specific expression.
Ghosh B, Barbosa E, Singh I
Molecular and cellular biochemistry 1995 Oct 4;151(1):77-81
Molecular and cellular biochemistry 1995 Oct 4;151(1):77-81
No comments: Submit comment
No validations: Submit validation data