HPA011316

ACSL1 antibody from Sigma-Aldrich
ACS1, FACL1, FACL2, LACS, LACS1, LACS2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011316
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011316, RRID:AB_1844536
Product name
Anti-ACSL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011316
Antibody type
Polyclonal
Antigen
Long-chain-fatty-acid--CoA ligase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YATRPKPLKPPCDLSMQSVEVAGSGGARRSALLDS
DEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRK
PDQPYEWLSYKQVAELSE
Storage
-20C
Provider Type Product Number
- No reagents -