H00055655-B01

NLRP2 antibody from Abnova Corporation
CLR19.9, FLJ20510, NALP2, NBS1, PAN1, PYPAF2

Antibody data

Product number
H00055655-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00055655-B01, RRID:AB_1204717
Product name
NLRP2 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00055655-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human NLRP2 protein.
Antigen sequence
MVSSAQMGFNLQALLEQLSQDELSKFKYLITTFSL
AHELQKIPHKEVDKADGKQLVEILTTHCDSYWVEM
ASLQVFEKMHRMDLSERAKDEVREAALKSFNKRKP
LSLGITRKERPPLDVDEMLERFKTEAQAFTETKGN
VICLGKEVFKGKKPDKDNRCRYILKTKFREMWKSW
PGDSKEVQVMAERYKMLIPFSNPRVLPGPFSYTVV
LYGPAGLGKTTLAQKLMLDWAEDNLIHKFKYAFYL
SCRELSRLGPCSFAELVFRDWPELQDDIPHILAQA
RKILFVIDGFDELGAAPGALIEDICGDWEKKKPVP
VLLGSLLNRVMLPKAALLVTTRPRALRDLRILAEE
PIYIRVEGFLEEDRRAYFLRHFGDEDQAMRAFELM
RSNAALFQLGSAPAVCWIVCTTLKLQMEKGEDPVP
TCLTRTGLFLRFLCSRFPQGAQLRGALRTLSLLAA
QGLWAQTSVLHREDLERLGVQESDLRLFLDGDILR
QDRVSKGCYSFIHLSFQQFLTALFYTLEKEEEEDR
DGHTWDIGDVQKLLSGVERLRNPDLIQAGYYSFGL
ANEKRAKELEATFGCRMSPDIKQELLRCDISCKGG
HSTVTDLQELLGCLYESQEEELVKEVMAQFKEISL
HLNAVDVVPSSFCVKHCRNLQKMSLQVIKENLPEN
VTASESDAEVERSQDDQHMLPFWTDLCSIFGSNKD
LMGLAINDSFLSASLVRILCEQIASDTCHLQRVVF
KNISPADAHRNLCLALRGHKTVTYLTLQGNDQDDM
FPALCEVLRHPECNLRYLGLVSCSATTQQWADLSL
ALEVNQSLTCVNLSDNELLDEGAKLLYTTLRHPKC
FLQRLSLENCHLTEANCKDLAAVLVVSRELTHLCL
AKNPIGNTGVKFLCEGLRYPECKLQTLVLWNCDIT
SDGCCDLTKLLQEKSSLLCLDLGLNHIGVKGMKFL
CEALRKPLCNLRCLWLWGCSIPPFSCEDLCSALSC
NQSLVTLDLGQNPLGSSGVKMLFETLTCSSGTLRT
LRLKIDDFNDELNKLLEEIEEKNPQLIIDTEKHHP
WAERPSSHDFMI
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -