Antibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [7]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA008066 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA008066, RRID:AB_1078378
- Product name
- Anti-CALD1
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SLKIEERAEFLNKSVQKSSGVKSTHQAAIVSKIDS
RLEQYTSAIEGTKSAKPTKPAASDLPVPAEGVRNI
KSMWEKGNVFSSPTAAGTPNKETAGLKVGVSSRIN
EWLTKTPDGNKSPAPKPSDLRPGDVSSKRNLWEKQ
SVDKVTS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Stromal gene expression defines poor-prognosis subtypes in colorectal cancer
Stromal gene expression defines poor-prognosis subtypes in colorectal cancer
Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy
Histochemical localization of caldesmon in the CNS and ganglia of the mouse.
Mapping the Subcellular Protein Distribution in Three Human Cell Lines
Calon A, Lonardo E, Berenguer-Llergo A, Espinet E, Hernando-Momblona X, Iglesias M, Sevillano M, Palomo-Ponce S, Tauriello D, Byrom D, Cortina C, Morral C, Barceló C, Tosi S, Riera A, Attolini C, Rossell D, Sancho E, Batlle E
Nature Genetics 2015 February;47(4):320-329
Nature Genetics 2015 February;47(4):320-329
Stromal gene expression defines poor-prognosis subtypes in colorectal cancer
Calon A, Lonardo E, Berenguer-Llergo A, Espinet E, Hernando-Momblona X, Iglesias M, Sevillano M, Palomo-Ponce S, Tauriello D, Byrom D, Cortina C, Morral C, Barceló C, Tosi S, Riera A, Attolini C, Rossell D, Sancho E, Batlle E
Nature Genetics 2015 February;47(4):320-329
Nature Genetics 2015 February;47(4):320-329
Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy
Stadler C, Hjelmare M, Neumann B, Jonasson K, Pepperkok R, Uhlén M, Lundberg E
Journal of Proteomics 2012 April;75(7):2236-2251
Journal of Proteomics 2012 April;75(7):2236-2251
Histochemical localization of caldesmon in the CNS and ganglia of the mouse.
Köhler CN
The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society 2011 May;59(5):504-17
The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society 2011 May;59(5):504-17
Mapping the Subcellular Protein Distribution in Three Human Cell Lines
Fagerberg L, Stadler C, Skogs M, Hjelmare M, Jonasson K, Wiking M, Åbergh A, Uhlén M, Lundberg E
Journal of Proteome Research 2011 August;10(8):3766-3777
Journal of Proteome Research 2011 August;10(8):3766-3777
No comments: Submit comment
Enhanced validation
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines U-251MG and MCF-7 using Anti-CALD1 antibody. Corresponding CALD1 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Western blot analysis using Anti-CALD1 antibody HPA008066 (A) shows similar pattern to independent antibody HPA017330 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & actin filaments.
- Sample type
- HUMAN
Enhanced validation
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human smooth muscle and skeletal muscle tissues using Anti-CALD1 antibody. Corresponding CALD1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex, placenta, skeletal muscle and smooth muscle using Anti-CALD1 antibody HPA008066 (A) shows similar protein distribution across tissues to independent antibody HPA017330 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human smooth muscle shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows low expression as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta using Anti-CALD1 antibody HPA008066.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex using Anti-CALD1 antibody HPA008066.
- Sample type
- HUMAN