HPA017330

CALD1 antibody from Sigma-Aldrich
CDM, H-CAD, L-CAD
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017330
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017330, RRID:AB_1845917
Product name
Anti-CALD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017330
Antibody type
Polyclonal
Antigen
Caldesmon recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MTHKLKHTENTFSRPGGRASVDTKEAEGAPQVEAG
KRLEELRRRRGETESEEFEKLKQKQQEAALELEEL
KKKREERRKVLEEEEQRRKQEEADRKLREEEEKRR
LKEEIERRRAEAAEKRQKMPEDGLSDD
Storage
-20C
Provider Type Product Number
- No reagents -