HPA028327

AKAP7 antibody from Sigma-Aldrich
AKAP15, AKAP18
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028327
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028327, RRID:AB_10601353
Product name
Anti-AKAP7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028327
Antibody type
Polyclonal
Antigen
A kinase (PRKA) anchor protein 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EFEANTMDSLVDMPFATVDIQDDCGITDEPQINLK
RSQENEWVKSDQVKKRKKKRKDYQPNYFLSIPITN
K
Storage
-20C
Provider Type Product Number
- No reagents -