Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA022829 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA022829, RRID:AB_1857438
- Product name
- Anti-SPHK1
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RFTLGTFLRLAALRTYRGRLAYLPVGRVGSKTPAS
PVVVQQGPVDAHLVPLEEPVPSHWTVVPDEDFVLV
LALLHSHLGSEMFAAPMGRCAAGVMHLFYV- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Regulation of hypoxia‐inducible factor functions in the nucleus by sphingosine‐1‐phosphate
Sphingosine Kinase 1 Signaling Promotes Metastasis of Triple-Negative Breast Cancer
TP53 is required for BECN1- and ATG5-dependent cell death induced by sphingosine kinase 1 inhibition
Hait N, Maiti A, Xu P, Qi Q, Kawaguchi T, Okano M, Takabe K, Yan L, Luo C
The FASEB Journal 2020;34(3):4293-4310
The FASEB Journal 2020;34(3):4293-4310
Sphingosine Kinase 1 Signaling Promotes Metastasis of Triple-Negative Breast Cancer
Acharya S, Yao J, Li P, Zhang C, Lowery F, Zhang Q, Guo H, Qu J, Yang F, Wistuba I, Piwnica-Worms H, Sahin A, Yu D
Cancer Research 2019;79(16):4211-4226
Cancer Research 2019;79(16):4211-4226
TP53 is required for BECN1- and ATG5-dependent cell death induced by sphingosine kinase 1 inhibition
Lima S, Takabe K, Newton J, Saurabh K, Young M, Leopoldino A, Hait N, Roberts J, Wang H, Dent P, Milstien S, Booth L, Spiegel S
Autophagy 2018
Autophagy 2018
No comments: Submit comment
No validations: Submit validation data