HPA008052

TRAF5 antibody from Sigma-Aldrich
RNF84
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008052
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008052, RRID:AB_1858230
Product name
Anti-TRAF5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008052
Antibody type
Polyclonal
Antigen
TNF receptor-associated factor 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NAKVILGRYQQDHLQQCLFQPVQCSNEKCREPVLR
KDLKEHLSASCQFRKEKCLYCKKDVVVINLQNHEE
NLCPEYPVFCPNNCAKIILKTEVDEHLAVCPEAEQ
DCPFKHYGCAVTDKR
Storage
-20C
Provider Type Product Number
- No reagents -