HPA023310

BAIAP2 antibody from Sigma-Aldrich
BAP2, IRSp53
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023310
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023310, RRID:AB_1845264
Product name
Anti-BAIAP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023310
Antibody type
Polyclonal
Antigen
Brain-specific angiogenesis inhibitor 1-associated protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLD
KDDLAIPPPDYGAASRAFPAQTASGFKQRPYSVAV
PAFSQGLDDYGARSMSRNP
Storage
-20C
Provider Type Product Number
- No reagents -