HPA008405

COL1A1 antibody from Sigma-Aldrich
OI4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008405
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008405, RRID:AB_1847089
Product name
Anti-COL1A1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008405
Antibody type
Polyclonal
Antigen
Collagen alpha-1(I) chain precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NLDAIKVFCNMETGETCVYPTQPSVAQKNWYISKN
PKDKRHVWFGESMTDGFQFEYGGQGSDPADVAIQL
TFLRLMSTEASQNITYHCKNSVAYMDQQTGNLK
Storage
-20C
Provider Type Product Number
- No reagents -