Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA053669 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA053669, RRID:AB_2682224
- Product name
- Anti-SIRT7
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
TPKDDWAALKLHGKCDDVMRLLMAELGLEIPAYSR
WQDPIFSLATPLRAGEEGSHSRKSLCRSREEAPPG
DRGAPLSSAPILGGWFGRGCTKRTK- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Sirtuins’ Deregulation in Bladder Cancer: SIRT7 Is Implicated in Tumor Progression through Epithelial to Mesenchymal Transition Promotion
SIRT7 Is a Prognostic Biomarker Associated With Immune Infiltration in Luminal Breast Cancer
Monteiro-Reis S, Lameirinhas A, Miranda-Gonçalves V, Felizardo D, Dias P, Oliveira J, Graça I, Gonçalves C, Costa B, Henrique R, Jerónimo C
Cancers 2020;12(5):1066
Cancers 2020;12(5):1066
SIRT7 Is a Prognostic Biomarker Associated With Immune Infiltration in Luminal Breast Cancer
Huo Q, Li Z, Cheng L, Yang F, Xie N
Frontiers in Oncology 2020;10
Frontiers in Oncology 2020;10
No comments: Submit comment
No validations: Submit validation data