Antibody data
- Antibody Data
- Antigen structure
- References [6]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184104 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Frizzled Family Receptor 7 (FZD7) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-FZD7 antibody: synthetic peptide directed towards the C terminal of human FZD7
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine, Chicken/Avian, Xenopus
- Host
- Rabbit
- Antigen sequence
PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRR
FYHRL SHSSKGETAV- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A unique combination of male germ cell miRNAs coordinates gonocyte differentiation.
Dual targeting of EphA2 and ER restores tamoxifen sensitivity in ER/EphA2-positive breast cancer.
Genotypic and phenotypic characterization of side population of gastric cancer cell lines.
Leptin receptor JAK2/STAT3 signaling modulates expression of Frizzled receptors in articular chondrocytes.
Frizzled-7 as a potential therapeutic target in colorectal cancer.
Frizzled-7 receptor ectodomain expression in a colon cancer cell line induces morphological change and attenuates tumor growth.
McIver SC, Stanger SJ, Santarelli DM, Roman SD, Nixon B, McLaughlin EA
PloS one 2012;7(4):e35553
PloS one 2012;7(4):e35553
Dual targeting of EphA2 and ER restores tamoxifen sensitivity in ER/EphA2-positive breast cancer.
Gökmen-Polar Y, Toroni RA, Hocevar BA, Badve S, Zhao Q, Shen C, Bruckheimer E, Kinch MS, Miller KD
Breast cancer research and treatment 2011 Jun;127(2):375-84
Breast cancer research and treatment 2011 Jun;127(2):375-84
Genotypic and phenotypic characterization of side population of gastric cancer cell lines.
Schmuck R, Warneke V, Behrens HM, Simon E, Weichert W, Röcken C
The American journal of pathology 2011 Apr;178(4):1792-804
The American journal of pathology 2011 Apr;178(4):1792-804
Leptin receptor JAK2/STAT3 signaling modulates expression of Frizzled receptors in articular chondrocytes.
Ohba S, Lanigan TM, Roessler BJ
Osteoarthritis and cartilage / OARS, Osteoarthritis Research Society 2010 Dec;18(12):1620-9
Osteoarthritis and cartilage / OARS, Osteoarthritis Research Society 2010 Dec;18(12):1620-9
Frizzled-7 as a potential therapeutic target in colorectal cancer.
Ueno K, Hiura M, Suehiro Y, Hazama S, Hirata H, Oka M, Imai K, Dahiya R, Hinoda Y
Neoplasia (New York, N.Y.) 2008 Jul;10(7):697-705
Neoplasia (New York, N.Y.) 2008 Jul;10(7):697-705
Frizzled-7 receptor ectodomain expression in a colon cancer cell line induces morphological change and attenuates tumor growth.
Vincan E, Darcy PK, Smyth MJ, Thompson EW, Thomas RJ, Phillips WA, Ramsay RG
Differentiation; research in biological diversity 2005 Apr;73(4):142-53
Differentiation; research in biological diversity 2005 Apr;73(4):142-53
No comments: Submit comment
No validations: Submit validation data