H00000659-M01

BMPR2 antibody from Abnova Corporation
BMPR-II, BMPR3, BRK-3, PPH1, T-ALK

Antibody data

Product number
H00000659-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000659-M01, RRID:AB_1137108
Product name
BMPR2 monoclonal antibody (M01), clone 4A2
Provider product page
Abnova Corporation - H00000659-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant BMPR2.
Antigen sequence
NSLDLSATNVLDGSSIQIGESTQDGKSGSGEKIKK
RVKTPYSLKRWRPSTWVISTESLDCEVNNNGSNRA
VHSKSSTAVYLAEGGTATTMVSKDIGMNC
Isotype
IgG
Antibody clone number
4A2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -