HPA017385

BMPR2 antibody from Sigma-Aldrich
BMPR-II, BMPR3, BRK-3, PPH1, T-ALK
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017385
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017385, RRID:AB_1845397
Product name
Anti-BMPR2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017385
Antibody type
Polyclonal
Antigen
Bone morphogenetic protein receptor type-2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PYQQDLGIGESRISHENGTILCSKGSTCYGLWEKS
KGDINLVKQGCWSHIGDPQECHYEECVVTTTPPSI
QNGTYRFCCCSTDLCNVNFTENFPPPDTTPLSPPH
SF
Storage
-20C
Provider Type Product Number
- No reagents -